| Protein or peptide name: | Norf1 |
| Chromosome: | Synechocystis sp. PCC 6803, complete genome |
| Protein or peptide start site: | 298972 |
| Protein or peptide end site: | 298826 |
| ncRNA start site: | 298972 |
| ncRNA end site: | 298826 |
| Genome Browser: | NA |
| Protein or peptide sequence: | MKLLEMLQDLMQYFTEAFARVFGPSDDEYPAVGVQPFDGEILVNSTEE |
| Protein or peptide length: | 48aa |
| ncRNA type: | ncRNA |
| ncRNA name: | norf1 |
| Entrez ID: | NA |
| Experimental species: | Cyanobacteria |
| Experimental techniques: | Western blotting |
| Experimental sample (cell line and/or tissue): | Synechocystis sp. PCC 6803 |
| Description: | To verify the existence of the respective μ-proteins in vivo, we selected five genes as examples to which a FLAG tag sequence was added and re-introduced them into Synechocystis sp. PCC 6803. These were the previously annotated gene ssr1169, two newly defined genes norf1 and norf4, as well as nsiR6 (nitrogen stress-induced RNA 6) and hliR1 (high light-inducible RNA 1), which originally were considered non-coding. |
| Subcellular location: | NA |
| Function: | We conclude that the observed induction of norf1 in response to shifts from light exposure to darkness is under transcriptional control. |
| Title of paper: | Small proteins in cyanobacteria provide a paradigm for the functional analysis of the bacterial micro-proteome |
| PMID: | 27894276 |
| Year of publication: | 2016 |
